PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G03220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 238aa    MW: 25568.8 Da    PI: 10.9494
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G03220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.26.1e-20143176134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++C + +Tp+WR+gpdg++tLCnaCG+++++ +
  OPUNC03G03220.1 143 CTHCAVDETPQWRHGPDGPRTLCNACGVRFKSGR 176
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.846137173IPR000679Zinc finger, GATA-type
SMARTSM004012.2E-17137187IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.9E-15140201No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14141174IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.91E-17142191No hitNo description
PfamPF003205.2E-18143176IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MVGDKDAAAL AGELTGDAGA SLNGFFDHTG LEAAVVGEGQ GEGEEEEELE WLSNKDAFPS  60
VDTMAAEVEA APGAPARAAV GPRTKGLRRR RRAAPGAPAR AAVGPRTKGL RRRRRVTAPW  120
SLAPLLSRPR QPAADAVAPR RRCTHCAVDE TPQWRHGPDG PRTLCNACGV RFKSGRLFPE  180
YRPANSPTFS PLLHSNSHRR VMEMRLQSEE DASAASRVNA KARRAERAAA RLAGKDKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1197960.0AC119796.2 Oryza sativa Japonica Group chromosome 3 clone OJ1172F09, complete sequence.
GenBankAK2427350.0AK242735.1 Oryza sativa Japonica Group cDNA, clone: J090048J08, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629220.11e-97PREDICTED: GATA transcription factor 3
TrEMBLA0A0E0K8P61e-169A0A0E0K8P6_ORYPU; Uncharacterized protein
STRINGORGLA03G0032900.12e-99(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-34GATA family protein